DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pal1 and pghm-1

DIOPT Version :9

Sequence 1:NP_001137630.2 Gene:Pal1 / 36033 FlyBaseID:FBgn0283510 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_490898.1 Gene:pghm-1 / 171746 WormBaseID:WBGene00022144 Length:324 Species:Caenorhabditis elegans


Alignment Length:298 Identity:61/298 - (20%)
Similarity:86/298 - (28%) Gaps:131/298 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 LVPEL-QLLCA----ADRENGRVQCF--LSSNGTFHSQYHNQLIG------DRLF---------- 332
            :|||. ..||.    :|:|| .:..|  |::.||.|   |..|.|      |.|.          
 Worm    32 VVPEADSYLCTSLELSDQEN-YLTGFKALTTKGTAH---HILLFGCEEPGSDELVWDCGEMNKPD 92

  Fly   333 -SMAYTPAAGGQLVI-----VNGPTAELGIHPEHYNEVHGFVLSMRSKQLVSKFGPNNLQFQNPH 391
             .|...|..|.:..|     ::.|..||                                   |.
 Worm    93 DEMPRAPTCGSKPAILYAWALDAPPLEL-----------------------------------PQ 122

  Fly   392 DVA--VTADGNEIYVAELNPMRIHKFVHRSLAKPMSLSASKDSRDSAISQAVGGDQVPAVAVHHP 454
            ||.  |..|.|..::.    |::| ::|           ||...|..           .:.:.|.
 Worm   123 DVGFRVGGDSNIRHLV----MQVH-YMH-----------SKQEPDET-----------GLEITHT 160

  Fly   455 SGKAILVASLMLLFAGSTFALALIFARRRK-----RGCL--------PFGARGRRH-------AW 499
            ......:|:.|||..|.|..       |.|     ..|:        ||..|...|       .|
 Worm   161 EEPQPKLAATMLLVTGGTLP-------RNKTESFETACMIEEDVVMHPFAYRTHTHRHGKEVSGW 218

  Fly   500 ------EKSDGFKLGGLLDRD-RNGFEKLDQQASDEEQ 530
                  :..|.:||.|..|.. ...|..::.||...:|
 Worm   219 LVKEDQKHEDHWKLIGRRDPQLAQMFVPVEDQAMTIQQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pal1NP_001137630.2 NHL_PAL_like 97..416 CDD:271328 33/155 (21%)
NHL repeat 111..172 CDD:271328
NHL repeat 178..220 CDD:271328
NHL repeat 230..267 CDD:271328
NHL repeat 283..321 CDD:271328 13/36 (36%)
NHL repeat 330..382 CDD:271328 8/67 (12%)
NHL repeat 388..415 CDD:271328 8/28 (29%)
pghm-1NP_490898.1 Cu2_monooxygen 27..145 CDD:279429 33/156 (21%)
Cu2_monoox_C 167..313 CDD:281675 23/97 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002923
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.