DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and MAF1

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001321570.1 Gene:MAF1 / 844042 AraportID:AT1G77080 Length:223 Species:Arabidopsis thaliana


Alignment Length:137 Identity:42/137 - (30%)
Similarity:76/137 - (55%) Gaps:21/137 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTD---- 61
            |||:||:|.||.::.:|||||:||:.|::.||.:||:||:..:|:::.|:|.|||..:|.|    
plant     1 MGRRKIEIKRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYDSSSGDDISK 65

  Fly    62 -MDRVLLKYTEYNE------------PHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEA 113
             :||..:::.:...            ||:.|.  ..:::.....:..|.|.:.:..:.|....| 
plant    66 IIDRYEIQHADELRALDLEEKIQNYLPHKELL--ETVQRLAVRHIFLPSSSDKKNVFFLLSTCE- 127

  Fly   114 KYNKIDE 120
             |:|::|
plant   128 -YSKLEE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 33/92 (36%)
HJURP_C 95..155 CDD:289143 7/26 (27%)
MAF1NP_001321570.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000108
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X116
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.