powered by:
Protein Alignment Mef2 and AT1G59920
DIOPT Version :9
Sequence 1: | NP_001260842.1 |
Gene: | Mef2 / 36032 |
FlyBaseID: | FBgn0011656 |
Length: | 606 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_176200.1 |
Gene: | AT1G59920 / 842286 |
AraportID: | AT1G59920 |
Length: | 132 |
Species: | Arabidopsis thaliana |
Alignment Length: | 53 |
Identity: | 13/53 - (24%) |
Similarity: | 21/53 - (39%) |
Gaps: | 5/53 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 GSPSPGPSPGIAHHLSIKQQS-----PGSQNGRASNLRVVIPPTIAPIPPNMS 256
|.||....|.:...|::|:.. .||.:...:|....|..|.....||::
plant 77 GEPSSSLPPRVLQDLNVKEDGDIPSMDGSHHQFETNRLTTITTTADACAPNIT 129
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Mef2 | NP_001260842.1 |
MADS_MEF2_like |
2..78 |
CDD:238165 |
|
HJURP_C |
95..155 |
CDD:289143 |
|
AT1G59920 | NP_176200.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5068 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.