DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AGL50

DIOPT Version :10

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_176190.1 Gene:AGL50 / 842274 AraportID:AT1G59810 Length:283 Species:Arabidopsis thaliana


Alignment Length:81 Identity:22/81 - (27%)
Similarity:38/81 - (46%) Gaps:12/81 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DERNRQVTFNKRKF-GVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEP- 75
            |.|.::.:|.|::| |..|||.||||||...:..|.:...:.|:.:..:.         ::|.. 
plant    16 DLRRKKQSFFKQRFPGFKKKASELSVLCGNSVGFICYGPDSDLHVWPQSQ---------DHNPQA 71

  Fly    76 -HESLTNKNIIEKENK 90
             ||.:...|.:..|.:
plant    72 LHEIVAKFNALSDERR 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 ARG80 1..>203 CDD:227400 22/81 (27%)
MADS_MEF2_like 2..78 CDD:238165 19/67 (28%)
AGL50NP_176190.1 MADS_SRF_like 18..90 CDD:238166 21/79 (27%)

Return to query results.
Submit another query.