DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AGL85

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_175874.1 Gene:AGL85 / 841917 AraportID:AT1G54760 Length:161 Species:Arabidopsis thaliana


Alignment Length:121 Identity:28/121 - (23%)
Similarity:47/121 - (38%) Gaps:31/121 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLT------------------ 80
            |||:||..|:|.:.:|.|.|.|.:.|.....|..::.. .|...||.                  
plant    20 ELSILCGAEVAFLGYSCSGKPYTFGSPSFQAVAERFLN-REASSSLQRSVMNAHQQAKIQELCKV 83

  Fly    81 -NKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKID-------EEFQNMMQR 128
             |:.:.|.:.:...:...:..|||    .|..|..:.|:|       ||.:.:|::
plant    84 YNRMVEEAKTEEAKVKKAAALAET----MPVDEDAWWKVDPKEVEDHEEAKKIMEK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 14/43 (33%)
HJURP_C 95..155 CDD:289143 10/41 (24%)
AGL85NP_175874.1 MADS <20..62 CDD:412166 14/42 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.