DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and CAL

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_564243.1 Gene:CAL / 839172 AraportID:AT1G26310 Length:255 Species:Arabidopsis thaliana


Alignment Length:132 Identity:47/132 - (35%)
Similarity:84/132 - (63%) Gaps:23/132 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTD-MDR 64
            |||.::::.||.::.||||||:||:.|::|||.|:|||||.|::||:||...||::|:|.. |::
plant     1 MGRGRVELKRIENKINRQVTFSKRRTGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSSESCMEK 65

  Fly    65 VLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDS-PEAETDYTLTPRTEAKYNKIDEEFQNMMQR 128
            ||.:|..|:.....|              ::||| ..|:|::::      :|:::..:.: :::|
plant    66 VLERYERYSYAERQL--------------IAPDSHVNAQTNWSM------EYSRLKAKIE-LLER 109

  Fly   129 NQ 130
            ||
plant   110 NQ 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 36/76 (47%)
HJURP_C 95..155 CDD:289143 9/37 (24%)
CALNP_564243.1 MADS_MEF2_like 2..79 CDD:238165 36/76 (47%)
K-box 85..175 CDD:366673 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3346
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000108
OrthoInspector 1 1.000 - - otm2406
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X116
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.