DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AGL31

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001119498.1 Gene:AGL31 / 836629 AraportID:AT5G65050 Length:196 Species:Arabidopsis thaliana


Alignment Length:90 Identity:39/90 - (43%)
Similarity:63/90 - (70%) Gaps:7/90 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTD-MDR 64
            |||||::|.||.::.:|||||:||:.|:::||.:||:||:..||:::.|.|.|||:.||.| |.:
plant     1 MGRKKVEIKRIENKSSRQVTFSKRRNGLIEKARQLSILCESSIAVLVVSGSGKLYKSASGDNMSK 65

  Fly    65 VLLKYTEYNEPH--ESLTNKNIIEK 87
            ::.:|    |.|  :.|...::.||
plant    66 IIDRY----EIHHADELEALDLAEK 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 35/78 (45%)
HJURP_C 95..155 CDD:289143
AGL31NP_001119498.1 MADS_MEF2_like 2..78 CDD:238165 35/79 (44%)
K-box <95..164 CDD:396188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000108
OrthoInspector 1 1.000 - - otm2406
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X116
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.