DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AGL39

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_198065.2 Gene:AGL39 / 832771 AraportID:AT5G27130 Length:306 Species:Arabidopsis thaliana


Alignment Length:212 Identity:47/212 - (22%)
Similarity:79/212 - (37%) Gaps:46/212 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLL 67
            ::||:|.:...:..|.||.:||:..|..||.:|.::....||:.:.|.|         |...|:.
plant    14 KRKIEIKKRETKEQRAVTCSKRRQTVFSKAADLCLISGANIAVFVTSPS---------DSSDVVY 69

  Fly    68 KYTEYNEPHE----SLTNKNIIEKENKNGVM------SPDSPEAETDYTLTPRTEAKYNKIDEEF 122
            .::.|:..:|    .|..|...:..|..|..      .||...:..|.       ::.:.|::..
plant    70 SFSGYSSAYEIADCYLNRKPPPKIVNPA
GSKLGFWWEDPDLYHSCDDL-------SELSIIEDRL 127

  Fly   123 QNMMQRNQMAIGGAGAPRQL-------PN------------SSYTLPVSVPVPGSYGDNLLQASP 168
            |. |:::.||........||       ||            |||:...|...|.|..:.....:.
plant   128 QR-MKKHVMACLEKEEKSQLVSSFDQNPNSTCSLDVEDCDGSSYSQIASTFTPNSVNEYCSDQTF 191

  Fly   169 QMSHTNISPRPSSSETD 185
            ...|.:.:|..||...|
plant   192 SSFHGDQNPNLSSPSFD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 20/78 (26%)
HJURP_C 95..155 CDD:289143 16/78 (21%)
AGL39NP_198065.2 MADS_SRF_like 13..97 CDD:238166 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.