DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and SEP1

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001119230.1 Gene:SEP1 / 831436 AraportID:AT5G15800 Length:262 Species:Arabidopsis thaliana


Alignment Length:156 Identity:53/156 - (33%)
Similarity:84/156 - (53%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQY-ASTDMDR 64
            |||.::::.||.::.||||||.||:.|::|||||||||||.|:||||||:..|||:: :|::|.:
plant     1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLK 65

  Fly    65 VLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRN 129
            .|.:|.:.:.....:.||...|.||                     :..:|.|:...::|:.::.
plant    66 TLDRYQKCSYGSIEVNNKPAKELEN---------------------SYREYLKLKGRYENLQRQQ 109

  Fly   130 QMAIGGAGAP----------RQLPNS 145
            :..:|....|          |||..|
plant   110 RNLLGEDLGPLNSKELEQLERQLDGS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 38/76 (50%)
HJURP_C 95..155 CDD:289143 9/61 (15%)
SEP1NP_001119230.1 MADS_MEF2_like 2..77 CDD:238165 38/74 (51%)
K-box 84..171 CDD:279785 12/73 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3346
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000108
OrthoInspector 1 1.000 - - otm2406
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X116
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.