DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AGL15

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001330207.1 Gene:AGL15 / 831224 AraportID:AT5G13790 Length:271 Species:Arabidopsis thaliana


Alignment Length:283 Identity:74/283 - (26%)
Similarity:116/283 - (40%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRV 65
            |||.||:|.||.:..:|||||:||:.|::|||.|||||||.|:|:|:||.|.||::|:||.|.:.
plant     1 MGRGKIEIKRIENANSRQVTFSKRRSGLLKKARELSVLCDAEVAVIVFSKSGKLFEYSSTGMKQT 65

  Fly    66 LLKY----------------------------TEYNEPHESLTNKNIIEKENKNGVMSPDSPEAE 102
            |.:|                            ::..|.|..|..|.:    |........|.|.:
plant    66 LSRYGNHQSSSASKAENLQEDCAEVDILKDQLSKLQEKHLQLQGKGL----NPLTFKELQSLEQQ 126

  Fly   103 TDYTLTPRTEAKYNKIDEEFQNMMQRNQMA-IGGAGAPRQ-------LPNSSYTLPVSVPVPGSY 159
            ..:.|....|.|...:..:.:....:.|.| :......||       ||:.::.:|..:      
plant   127 LYHALITVRERKERLLTNQLEESRLKEQRAELENETLRRQVQELRSFLPSFTHYVPSYI------ 185

  Fly   160 GDNLLQASPQMSHTNISPRPSSSETDSVYPSGSMLEMS-NGYPHSHSPLVGSPSPGPSPGIAHHL 223
              ......|:.:..|...:.|...||    |.:.|::. .|..|......|......|..:..:.
plant   186 --KCFAIDPKNALINHDSKCSLQNTD----SDTTLQLGLPGEAHDRRTNEGERESPSSDSVTTNT 244

  Fly   224 SIKQQSPGSQNGRASNLRVVIPP 246
            |.:....|.|:..|::     ||
plant   245 SSETAERGDQSSLANS-----PP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 41/103 (40%)
HJURP_C 95..155 CDD:289143 12/67 (18%)
AGL15NP_001330207.1 MADS_MEF2_like 2..78 CDD:238165 39/75 (52%)
K-box 75..168 CDD:396188 14/96 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3346
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000108
OrthoInspector 1 1.000 - - otm2406
orthoMCL 1 0.900 - - OOG6_103662
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X116
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.