DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AGL96

DIOPT Version :10

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_196268.1 Gene:AGL96 / 830538 AraportID:AT5G06500 Length:242 Species:Arabidopsis thaliana


Alignment Length:31 Identity:8/31 - (25%)
Similarity:15/31 - (48%) Gaps:4/31 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 LGSDLKR----EGKQTAVLVHKAINQSSKTP 362
            :|...|:    :|.|:...|.|..::..:||
plant    29 MGKPKKKGASPQGSQSLQEVKKRGHRMRRTP 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 ARG80 1..>203 CDD:227400
MADS_MEF2_like 2..78 CDD:238165
AGL96NP_196268.1 MADS_SRF_like 2..85 CDD:238166 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.