DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AGL52

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_192864.1 Gene:AGL52 / 826727 AraportID:AT4G11250 Length:329 Species:Arabidopsis thaliana


Alignment Length:326 Identity:68/326 - (20%)
Similarity:117/326 - (35%) Gaps:86/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDR-----VLLKYTEYNEPHESLTNKNIIEK 87
            :.|||.|||:||..::.:|.:.....|..:..   ||     :.|:|.|..:..:.|.....:||
plant    22 IFKKAEELSILCAIDVCVIYYGPDGDLRTWPK---DRETVKNMALRYKEDRKRKKCLNLHEFLEK 83

  Fly    88 ENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAGAPRQLPNSSYTLPVS 152
            |.   |...|..:.:|:|...|.....::....:     |.:|:.       :.|..:..||...
plant    84 EK---VKDKDKYKGKTNYVKNPNWYPNFDHYSPQ-----QLSQLI-------QSLERTLSTLQKR 133

  Fly   153 VPVPGS---YGDNLLQASPQMSHTNISPRPSSSETDSVYPSGSMLEMSNGYPHSHSPLVGSPSPG 214
            :.:..|   ...||:..|...|:.|        :|..:.||...|.|   |.|..:.|...|   
plant   134 LRIVESQKKQNTNLVHQSLTPSYLN--------QTQHLDPSKFSLYM---YNHGDATLSQLP--- 184

  Fly   215 PSPGIAHHLSIKQQSP----GSQNGRASNLRVVIPPTIAPIPPNMSAPDDVGYADQRQSQTSLNT 275
                    ||..|.:.    ..|:|...|:.:                |::...:..|.....||
plant   185 --------LSASQSNQLINYQMQHGFGQNMCL----------------DNITNNNNFQHPGVSNT 225

  Fly   276 PVVTLQTPIPALTSYSFGAQDFSSSGVMNSADIMSLNTWHQGLV-------PHSSLSHLAVSNST 333
                 |...|.|::.::|.    ::.:|...|  .|:.:.|.|.       .::.|.|..:||:.
plant   226 -----QDYSPLLSANNYGL----NNHLMQQQD--QLHGFDQNLCMMSEIINNNNGLQHPNLSNTV 279

  Fly   334 P 334
            |
plant   280 P 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 15/54 (28%)
HJURP_C 95..155 CDD:289143 9/59 (15%)
AGL52NP_192864.1 MADS <13..78 CDD:381807 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.