DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and STK

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001319889.1 Gene:STK / 826586 AraportID:AT4G09960 Length:329 Species:Arabidopsis thaliana


Alignment Length:247 Identity:67/247 - (27%)
Similarity:110/247 - (44%) Gaps:39/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRV 65
            |||.||:|.||.:..||||||.||:.|::|||||||||||.|:|||:||:..:||:||:.::...
plant    96 MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNNIRST 160

  Fly    66 LLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYN----KIDEEFQNMM 126
            :   ..|.:.....||.:.:::.|                      .|.|.    |:.::.|.:.
plant   161 I---ERYKKACSDSTNTSTVQEIN----------------------AAYYQQESAKLRQQIQTIQ 200

  Fly   127 QRNQMAIG---GAGAPRQLPNSSYTLPVSVPVPGSYGDNLLQASPQMSHTNISPRPSSSETDSVY 188
            ..|:..:|   .:.:.::|......|..::....|....||....:.:...:..:....:.:::|
plant   201 NSNRNLMGDSLSSLSVKELKQVENRLEKAISRIRSKKHELLLVEIENAQKRLILQEIELDNENIY 265

  Fly   189 PSGSMLEMSNGYPHSHSPLVGS-----PSPGPSPGIAHHLSIKQQSPGSQNG 235
            ....:.|:.....|.|..:.||     .:.......||  ||.....||.||
plant   266 LRTKVAEVERYQQHHHQMVSGSEINAIEALASRNYFAH--SIMTAGSGSGNG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 38/75 (51%)
HJURP_C 95..155 CDD:289143 8/66 (12%)
STKNP_001319889.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3346
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000108
OrthoInspector 1 1.000 - - otm2406
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X116
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.