DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AGL18

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_191298.1 Gene:AGL18 / 824906 AraportID:AT3G57390 Length:256 Species:Arabidopsis thaliana


Alignment Length:262 Identity:75/262 - (28%)
Similarity:117/262 - (44%) Gaps:78/262 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRV 65
            |||.:|:|.:|.:..:|||||:||:.|::|||.|||:|||.|:|||||||:.|:|.::|..|:::
plant     1 MGRGRIEIKKIENINSRQVTFSKRRNGLIKKAKELSILCDAEVALIIFSSTGKIYDFSSVCMEQI 65

  Fly    66 LLKY------TEYNEPHE-------SLTNKNIIEKENK--------------------NGVMSPD 97
            |.:|      ||:.:..|       |..|:.::..::.                    .|:..||
plant    66 LSRYGYTTASTEHKQQREHQLLICASHGNEAVLRNDDSMKGELERLQLAIERLKGKELEGMSFPD 130

  Fly    98 --SPEAETDYTL----TPRTEAKYNKIDEE--------FQNMMQRNQMAIGGAGAPRQLPNSSYT 148
              |.|.:.:.:|    ..:|:...|:|:..        .:|.:.|.|:.:.|.|:          
plant   131 LISLENQLNESLHSVKDQKTQILLNQIERSRIQEKKALEENQILRKQVEMLGRGS---------- 185

  Fly   149 LPVSVPVPGSYGDNLLQASPQMSHTNISPRPSSSETDSVYPSGSMLEMSNGYPHSHSPL-VGSPS 212
                       |..:|...||.|.....|..||||.|         |..|...||.:.| :|..|
plant   186 -----------GPKVLNERPQDSSPEADPESSSSEED---------ENDNEEHHSDTSLQLGLSS 230

  Fly   213 PG 214
            .|
plant   231 TG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 39/88 (44%)
HJURP_C 95..155 CDD:289143 13/73 (18%)
AGL18NP_191298.1 MADS_MEF2_like 2..75 CDD:238165 36/72 (50%)
K-box 94..179 CDD:396188 13/84 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3346
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000108
OrthoInspector 1 1.000 - - otm2406
orthoMCL 1 0.900 - - OOG6_103662
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X116
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.