DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and SEP2

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_186880.1 Gene:SEP2 / 821151 AraportID:AT3G02310 Length:250 Species:Arabidopsis thaliana


Alignment Length:235 Identity:66/235 - (28%)
Similarity:106/235 - (45%) Gaps:61/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYAST-DMDR 64
            |||.::::.||.::.||||||.||:.|::|||||||||||.|::||:||:..|||::.|| :|.:
plant     1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLK 65

  Fly    65 VLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRN 129
            .|.:|.:.:.....:.||...|.||                     :..:|.|:...::|:.::.
plant    66 TLERYQKCSYGSIEVNNKPAKELEN---------------------SYREYLKLKGRYENLQRQQ 109

  Fly   130 QMAIGGAGAP----------RQLPNS---------SYTLPVSVPVPGSYGDNLLQASPQMS---- 171
            :..:|....|          |||..|         .|.|.....:.|. ...||.|:..:|    
plant   110 RNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGK-EHILLDANRALSMKLE 173

  Fly   172 ------HTNISPRPSSSETDSVYPSGSMLEMSNGYPHSHS 205
                  |.:|.         ..:..|....::.|:|.:||
plant   174 DMIGVRHHHIG---------GGWEGGDQQNIAYGHPQAHS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 37/76 (49%)
HJURP_C 95..155 CDD:289143 11/78 (14%)
SEP2NP_186880.1 MADS_MEF2_like 2..77 CDD:238165 37/74 (50%)
K-box 84..173 CDD:396188 19/110 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3346
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000108
OrthoInspector 1 1.000 - - otm2406
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X116
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.