DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AGL6

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_182089.1 Gene:AGL6 / 819173 AraportID:AT2G45650 Length:252 Species:Arabidopsis thaliana


Alignment Length:210 Identity:64/210 - (30%)
Similarity:106/210 - (50%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRV 65
            |||.::::.||.::.||||||:||:.|::|||||||||||.|:|||||||..|||::.|..::..
plant     1 MGRGRVEMKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSVGIEST 65

  Fly    66 LLKY------------------------TEYNEPHESL--TNKNII-EKENKNGVMSPDSPEAET 103
            :.:|                        |:....:|||  ||:|:: |...:.||....:.|.:.
plant    66 IERYNRCYNCSLSNNKPEETTQSWCQEVTKLKSKYESLVRTNRNLLGEDLGEMGVKELQALERQL 130

  Fly   104 DYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAGAPRQLPNSSYTLPVSVPVPGSYGDNLLQASP 168
            :..||...:.|...:.||.:::.::.          |||.:.:..|.:.....| :.....|...
plant   131 EAALTATRQRKTQVMMEEMEDLRKKE----------RQLGDINKQLKIKFETEG-HAFKTFQDLW 184

  Fly   169 QMSHTNISPRPSSSE 183
            ..|..:::..|::||
plant   185 ANSAASVAGDPNNSE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 38/99 (38%)
HJURP_C 95..155 CDD:289143 10/59 (17%)
AGL6NP_182089.1 MADS_MEF2_like 2..72 CDD:238165 37/69 (54%)
K-box 87..171 CDD:366673 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3346
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000108
OrthoInspector 1 1.000 - - otm2406
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X116
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.