powered by:
Protein Alignment Mef2 and AGL33
DIOPT Version :9
Sequence 1: | NP_001260842.1 |
Gene: | Mef2 / 36032 |
FlyBaseID: | FBgn0011656 |
Length: | 606 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_180200.1 |
Gene: | AGL33 / 817172 |
AraportID: | AT2G26320 |
Length: | 109 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 27/71 - (38%) |
Similarity: | 44/71 - (61%) |
Gaps: | 2/71 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNK--LYQYASTDMD 63
|||||:::.||...:.|...|:|||.|:.|||.|:::|||.:|.||:.|.:.| ::...|....
plant 17 MGRKKLKLKRIESLKERSSKFSKRKKGLFKKAEEVALLCDSDIMLIVVSPTEKPTVFNTRSRSFH 81
Fly 64 RVLLKY 69
.:|.::
plant 82 TILERF 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5068 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.