DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AGL61

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_850058.1 Gene:AGL61 / 817021 AraportID:AT2G24840 Length:264 Species:Arabidopsis thaliana


Alignment Length:230 Identity:64/230 - (27%)
Similarity:98/230 - (42%) Gaps:53/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRV 65
            :||:||.:.:|..|.:|||||:||:.|:.|||.||..||..||.:|:||.:.|.:.:....::.|
plant    62 IGRQKIPMVKIKKESHRQVTFSKRRAGLFKKASELCTLCGAEIGIIVFSPAKKPFSFGHPSVESV 126

  Fly    66 LLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEA--ETDYTLT-----PRTEAKYNKIDEEFQ 123
            |.:|...|       |.::.:.:...|     ||.|  |.:..||     ...|.|..:..||.:
plant   127 LDRYVSRN-------NMSLAQSQQLQG-----SPAASCELNMQLTHILSEVEEEKKKGQAMEEMR 179

  Fly   124 NMMQRNQMAIGGAGAPRQLPNSSYTLPVSVPVPGSYGDNLLQ------ASPQMSHTNISPRPSSS 182
            ....|..|.            :.:..||...       |::|      |..::..|.::...|.:
plant   180 KESVRRSMI------------NWWEKPVEEM-------NMVQLQEMKYALEELRKTVVTNMASFN 225

  Fly   183 ET-DSVYPSGSMLEMSNGYPHSHSPLVGSPSPGPS 216
            |. |.|:   ..|:.....|    |.|..|| |||
plant   226 EAKDDVF---GFLDNKVTVP----PYVNMPS-GPS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 31/75 (41%)
HJURP_C 95..155 CDD:289143 14/66 (21%)
AGL61NP_850058.1 MADS_MEF2_like 63..130 CDD:238165 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.