DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AT5G27944

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001119289.1 Gene:AT5G27944 / 6240316 AraportID:AT5G27944 Length:224 Species:Arabidopsis thaliana


Alignment Length:210 Identity:49/210 - (23%)
Similarity:80/210 - (38%) Gaps:41/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLK 68
            ||..:|. :....:....:.|:..:.|||.|||.|||.|:.:|::....:|.:....|..:|...
plant    22 KKSSLSS-SSTAKKTTNLSMREQTMFKKALELSTLCDIEVCVILYGRDGELIKTWPEDQSKVRDM 85

  Fly    69 YTEYNEPHE----------SLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQ 123
            ...::..||          ||..:..|..:||   :|....|.|.  :|........||:   ..
plant    86 AERFSRLHERERCKKRTNLSLFLRKKILDDNK---LSEKVLEMED--SLESGLRVLQNKL---LL 142

  Fly   124 NMMQRNQMAIGGAGAPRQLPNSSYTLPVSVPVPGSYGDNLLQASPQMSHTNISPRP---SSSETD 185
            ...::||..:|.:.|.     ||.|             ||| :||:..|......|   ..|.|:
plant   143 LQPEKNQTKLGQSRAV-----SSTT-------------NLL-SSPENHHNQQWTEPLENGVSNTE 188

  Fly   186 SVYPSGSMLEMSNGY 200
            ....:.|:.:..:.|
plant   189 QELSTSSLSQHQSKY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 20/83 (24%)
HJURP_C 95..155 CDD:289143 13/59 (22%)
AT5G27944NP_001119289.1 MADS_SRF_like 35..103 CDD:238166 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.