DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and srfb

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_956925.1 Gene:srfb / 393604 ZFINID:ZDB-GENE-040426-1294 Length:314 Species:Danio rerio


Alignment Length:206 Identity:52/206 - (25%)
Similarity:85/206 - (41%) Gaps:53/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVL 66
            ||.||::..|.::..|..||:|||.|:||||||||.|...::.|::.|.:..:|.:|:..:..::
Zfish   157 GRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMI 221

  Fly    67 LKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRNQM 131
                      .|.|.|.:|:    ..:.|||||         ||::.                  
Zfish   222 ----------TSETGKALIQ----TCLNSPDSP---------PRSDC------------------ 245

  Fly   132 AIGGAGAPRQLPNSSY---TLPVSVPVPGSYGDNLLQASPQMSHTNISPRPSSSETDSVYPSGSM 193
                  :.:::..|.|   .|...|....|.|:......|..:   :|..|.|:....|.|:.|:
Zfish   246 ------SDQRMSASGYEETELTYQVSESESLGEGKDSLKPVFT---VSSLPGSTSATPVTPTSSV 301

  Fly   194 LEMSNGYPHSH 204
            |..:.....||
Zfish   302 LHTALTCSVSH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 25/75 (33%)
HJURP_C 95..155 CDD:289143 11/62 (18%)
srfbNP_956925.1 MADS_SRF_like 157..238 CDD:238166 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.