DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and bs

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001286837.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster


Alignment Length:262 Identity:67/262 - (25%)
Similarity:105/262 - (40%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVL 66
            ||.||::..|.::..|..||:|||.|:||||||||.|...::.|::.|.:..:|.:|:..:..::
  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 230

  Fly    67 LKYTEYNEPHESLTNKNIIEKENKNGVMSPDSP-----EAETDYTLTPRTEAKYNKIDEEFQNMM 126
                      .|...|.:|:    ..:.|||.|     :.....|....||..||..||:.::  
  Fly   231 ----------TSEAGKQLIQ----TCLNSPDPPSVGGGDQRMSATGFEETELSYNIADEDSKD-- 279

  Fly   127 QRNQMAIGGAGAPRQLPNSSYTLPVSVPVPGSYGDNLLQASPQMSHTNISPRPSSSETDSVYPSG 191
            .|:..:.|.        .|..:..|.:|...:.....|.|    |.|.:|..|::|.:.:...||
  Fly   280 DRSPTSSGN--------ESDDSSDVEMPAEAAEVATKLPA----SKTEVSAPPAASCSAATASSG 332

  Fly   192 SMLEMSNGYPHSHSPLVG---SPSPGPSPGIAHHLSIKQQSPGSQNGRASNLRVVIPPTIAPIPP 253
                      |...|.:.   ..:.|||...|          ....|.|.:..|....:||.||.
  Fly   333 ----------HKTMPALNYQTDTNSGPSTSTA----------AGGGGSADSKYVYSAASIANIPQ 377

  Fly   254 NM 255
            .|
  Fly   378 KM 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 25/75 (33%)
HJURP_C 95..155 CDD:289143 15/64 (23%)
bsNP_001286837.1 MADS_SRF_like 166..247 CDD:238166 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.