DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mef2 and AT4G37435

DIOPT Version :9

Sequence 1:NP_001260842.1 Gene:Mef2 / 36032 FlyBaseID:FBgn0011656 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001328728.1 Gene:AT4G37435 / 28720212 AraportID:AT4G37435 Length:186 Species:Arabidopsis thaliana


Alignment Length:133 Identity:46/133 - (34%)
Similarity:73/133 - (54%) Gaps:12/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQ-YASTDMDR 64
            |||.||||.||.|.:.|.:.|.|||.|::||||||.|||:..:|||:||.|.||:. ||....:.
plant     1 MGRVKIQIKRINDRQQRNIAFAKRKNGLLKKAYELFVLCNVPVALILFSPSGKLFVFYAKERPEE 65

  Fly    65 VLLKY----TEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNM 125
            ::.|:    .....|||....:.:::..::. ..|.:|.:....|.:.|:      :|::|.:.:
plant    66 IICKFLARAVRTRLPHEPNIQRLVMQMRSET-KCSDESLDDGLRYLIQPK------EIEDEIEEV 123

  Fly   126 MQR 128
            ..|
plant   124 NAR 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mef2NP_001260842.1 MADS_MEF2_like 2..78 CDD:238165 37/80 (46%)
HJURP_C 95..155 CDD:289143 7/34 (21%)
AT4G37435NP_001328728.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000108
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11945
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.