DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFa and RBM12B

DIOPT Version :9

Sequence 1:NP_523669.2 Gene:FMRFa / 36030 FlyBaseID:FBgn0000715 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001364889.1 Gene:RBM12B / 389677 HGNCID:32310 Length:1001 Species:Homo sapiens


Alignment Length:371 Identity:97/371 - (26%)
Similarity:132/371 - (35%) Gaps:137/371 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PPQDNDLVDALLGNDQTERAELEFRHPISVIGIDYSKNAVVLHFQKHGRKPRYKYD---PELEAK 103
            ||:|                  :||||                .::..|:| .:.|   |..|..
Human   606 PPED------------------DFRHP----------------REEDWRRP-LEEDWRRPLEEDF 635

  Fly   104 RRSVQDNFMH-----FGKRQAEQL----------PPEGSYAESDE------LEGMAKRAAMDRYG 147
            |||..::|..     |.:...|.|          |||..:....|      |:|..:|...|.:.
Human   636 RRSPTEDFRQLPEEDFRQPPEEDLRWLPEEDFRRPPEEDWRRPPEEDFRRPLQGEWRRPPEDDFR 700

  Fly   148 RDPKQDFMRFGRDPKQDFMR-----FGRDPKQDFMR-----FGRDPKQDFMR-----FGRDPKQD 197
            |.|::||.   ..|::||.:     |.|.|::.|.|     |.|.|.:.|.|     |.|.|.:.
Human   701 RPPEEDFR---HSPEEDFRQSPQEHFRRPPQEHFRRPPPEHFRRPPPEHFRRPPPEHFRRPPPEH 762

  Fly   198 FMR-----FGRTPAEDFMR-----FGRTPAEDFMRFGRSDNFMR-------------FGRSPHEE 239
            |.|     |.|.|.|.|.|     |.|.|.|.|.| .|.::|..             |...|.|:
Human   763 FRRPPPEHFRRPPPEHFRRPPQEHFRRPPQEHFRR-SREEDFRHPPDEDFRGPPDEDFRHPPDED 826

  Fly   240 LRSPK---------QDFMRFGR-------------PDNFMRFG---RSAPQD------FVRSGKM 273
            .|||:         :||.:...             ||||...|   ||.|.|      ||..|:.
Human   827 FRSPQEEDFRCPSDEDFRQLPEEDLREAPEEDPRLPDNFRPPGEDFRSPPDDFRSHRPFVNFGRP 891

  Fly   274 DSNFIRFGKSLKPAAPESK---PVKSNQGNPGERSPVDKAMTELFK 316
            :.....|||....:.||.:   ..|.|.|: |..:|: |.|...||
Human   892 EGGKFDFGKHNMGSFPEGRFMPDPKINCGS-GRVTPI-KIMNLPFK 935

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaNP_523669.2 None
RBM12BNP_001364889.1 RRM1_RBM12B 2..80 CDD:410139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..147
RRM2_RBM12B 153..238 CDD:410140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..278
RRM3_RBM12B 284..363 CDD:409935
RRM4_RBM12B 400..475 CDD:410142
PTZ00121 <449..680 CDD:173412 22/108 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 544..587
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 631..882 69/254 (27%)
PHA03321 <689..915 CDD:223041 64/229 (28%)
RRM5_RBM12B 925..1001 CDD:410144 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.