DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFa and flp-3

DIOPT Version :9

Sequence 1:NP_523669.2 Gene:FMRFa / 36030 FlyBaseID:FBgn0000715 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_509694.1 Gene:flp-3 / 181221 WormBaseID:WBGene00001446 Length:184 Species:Caenorhabditis elegans


Alignment Length:167 Identity:62/167 - (37%)
Similarity:83/167 - (49%) Gaps:41/167 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MHFGKRQ-AEQLP-PEGSYAESDELEGMAKRAAMD------RYGRDPKQDFMRFGRDPKQDF--M 166
            |.||||. |:::. .|..|..|:.   |.||:.:|      |..|.| ...||||:...:.|  |
 Worm    33 MRFGKRAIADEMTFEEDGYYPSNV---MWKRSTVDSSEPVIRDQRTP-LGTMRFGKRSAEPFGTM 93

  Fly   167 RFG-RDPKQD----FMRFGRDPKQD----FMRFGR--DPKQDF--MRFGRTPAED---FMRFGRT 215
            ||| |:|:.|    .||||:...:|    .||||:  |....|  |:||:..||:   .||||:.
 Worm    94 RFGKRNPENDTPFGTMRFGKRASEDALFGTMRFGKREDGNAPFGTMKFGKREAEEPLGTMRFGKR 158

  Fly   216 PAEDFMRFGRSDNFMRFGRSPHEELRSPKQDFMRFGR 252
            .|:|...||.    ||||:      |:| ...||||:
 Worm   159 SADDSAPFGT----MRFGK------RNP-LGTMRFGK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaNP_523669.2 None
flp-3NP_509694.1 UxaC <36..121 CDD:294540 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20986
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.