DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFa and flp-18

DIOPT Version :10

Sequence 1:NP_523669.2 Gene:FMRFa / 36030 FlyBaseID:FBgn0000715 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_508514.2 Gene:flp-18 / 180587 WormBaseID:WBGene00001461 Length:208 Species:Caenorhabditis elegans


Alignment Length:185 Identity:53/185 - (28%)
Similarity:74/185 - (40%) Gaps:51/185 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 KYDPELEAKR--RSVQDNFMHFGKRQAEQLPPEGSYAESDELEGM---AKRAAMDRYGRDPKQDF 154
            |.|..:.:||  .......:.||||.......|.| .:..|:.|:   .|||..|.....|  ..
 Worm    47 KQDGRVFSKRDFDGAMPGVLRFGKRGGVWEKRESS-VQKKEMPGVLRFGKRAYFDEKKSVP--GV 108

  Fly   155 MRFGR----DPKQD---FMRFGRDPKQDFMRFGRDPKQD------FMRFGRDPKQDFMRFGRTPA 206
            :|||:    |.|:.   .:|||:          ||...|      .:|||   |:|:|      |
 Worm   109 LRFGKRSYFDEKKSVPGVLRFGK----------RDVPMDKREIPGVLRFG---KRDYM------A 154

  Fly   207 EDFMRFGRTPAEDFMRFGRSD--NFMRFG-RSPHEE------LRSPKQDFMRFGR 252
            :.|.:....|.  .:|||:.|  ..:||| ||..||      |:......:||||
 Worm   155 DSFDKRSEVPG--VLRFGKRDVPGVLRFGKRSDLEEHYAGVLLKKSVPGVLRFGR 207

Return to query results.
Submit another query.