DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFa and flp-6

DIOPT Version :9

Sequence 1:NP_523669.2 Gene:FMRFa / 36030 FlyBaseID:FBgn0000715 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_505444.1 Gene:flp-6 / 179327 WormBaseID:WBGene00001449 Length:170 Species:Caenorhabditis elegans


Alignment Length:165 Identity:52/165 - (31%)
Similarity:75/165 - (45%) Gaps:41/165 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SYAESD---ELEGMAKRAAMDRYGRDP----------KQDFMRFGR----DPKQDFMRFGRDP-- 172
            ::|:.|   |.|.|.:::|..|:||..          |..:||||:    ..:|:.:  |.|.  
 Worm    17 AFAQQDSEVEREMMKRKSAYMRFGRSDGGNPMEMEKRKSAYMRFGKRSSGGDEQELV--GGDDID 79

  Fly   173 ----KQDFMRFGR--DPKQDFMRFGRDPKQDFMRFGRTPAEDFMRFGRT----PAEDFMRFGRSD 227
                |..:||||:  .|::|.|...: .|..:||||:. :.|....|..    .|.|.  |.|..
 Worm    80 MEKRKSAYMRFGKRSGPQEDDMPMEK-RKSAYMRFGKR-SSDMEVIGNEGVDGDAHDL--FKRKS 140

  Fly   228 NFMRFG-RSPHEELRSPKQDFMRFGRPDNFMRFGR 261
            .:|||| ||..||   ...|.|:  |...:|||||
 Worm   141 AYMRFGKRSMGEE---EDHDMMK--RKSAYMRFGR 170



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_119404
Panther 1 1.100 - - O PTHR20986
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.