DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFa and flp-17

DIOPT Version :10

Sequence 1:NP_523669.2 Gene:FMRFa / 36030 FlyBaseID:FBgn0000715 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_503051.1 Gene:flp-17 / 178498 WormBaseID:WBGene00001460 Length:130 Species:Caenorhabditis elegans


Alignment Length:85 Identity:28/85 - (32%)
Similarity:36/85 - (42%) Gaps:36/85 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KRRSVQDNFMHFGKRQAEQLPPEGSYAESDELEGMAKRAAMDRYGRDPKQDFMRFGRDPKQDFMR 167
            ||:|.   |:.||||.|    ||      :|...|.||          |..|:||||.       
 Worm    76 KRKSA---FVRFGKRSA----PE------EEAMEMEKR----------KSAFVRFGRS------- 110

  Fly   168 FGRDP------KQDFMRFGR 181
            ||.:|      |..::|||:
 Worm   111 FGMEPQITEKRKSQYIRFGK 130

Return to query results.
Submit another query.