DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1441 and AT3G60060

DIOPT Version :9

Sequence 1:NP_610535.1 Gene:CG1441 / 36029 FlyBaseID:FBgn0033464 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_191565.1 Gene:AT3G60060 / 825176 AraportID:AT3G60060 Length:154 Species:Arabidopsis thaliana


Alignment Length:131 Identity:31/131 - (23%)
Similarity:47/131 - (35%) Gaps:35/131 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IDDNEVDRIAECFKGRS-LFITGGTGFLGKVLVEKLLRSCGGLKRIYLLIRPKKGKDPQERIKDI 83
            :|...|...:.||..|. ||:||..     |||.|........||:|....|.            
plant     4 VDLGSVRLFSFCFLARERLFVTGKI-----VLVIKANDQEAAKKRLYFQFHPS------------ 51

  Fly    84 FQNVLFDQVKQMRGEEHILQQVVAIAGDVLSPGLGISEKDLETLRQEVSIVYHCAATVRFDEPLR 148
                             ||.:::.:..|:....||:..:....:.:|:.|:...|||..||:.|.
plant    52 -----------------ILSKLLPVVEDIAEDNLGVDSETSLKISEEIDIIISSAATTTFDDSLW 99

  Fly   149 N 149
            |
plant   100 N 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1441NP_610535.1 PLN02996 24..464 CDD:215538 30/127 (24%)
FAR-N_SDR_e 35..348 CDD:187547 27/116 (23%)
Sterile 385..475 CDD:281068
AT3G60060NP_191565.1 NADB_Rossmann 25..>98 CDD:304358 22/106 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3320
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.