DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1513 and HES1

DIOPT Version :9

Sequence 1:NP_610534.3 Gene:CG1513 / 36028 FlyBaseID:FBgn0033463 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_014880.3 Gene:HES1 / 854412 SGDID:S000005763 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:382 Identity:110/382 - (28%)
Similarity:178/382 - (46%) Gaps:48/382 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 LSMEAHGSMITHLLSQV-KIGMDLTKVVLPTFILERRSLLEMYADYFA-HPDLFIKISDLD---- 468
            :|..|..|..|..|..: ....||:.:..|.|||...||.| ::.|:| ||.||::.|.:|    
Yeast     1 MSQHASSSSWTSFLKSISSFNGDLSSLSAPPFILSPTSLTE-FSQYWAEHPALFLEPSLIDGENY 64

  Fly   469 ------DPR------DRIVQVCRWYMS---AYHAGRKSAVA--KKPYNPILGEVFQCHWDIPGIS 516
                  ||.      .:::.|.||::|   :.:..|..::.  |||.||.|||||...|      
Yeast    65 KDHCPFDPNVESKEVAQMLAVVRWFISTLRSQYCSRSESMGSEKKPLNPFLGEVFVGKW------ 123

  Fly   517 QDAQEVRDGPVPWCRRDQLTFLAEQVSHHPPISAFYAEHYNKKITFAAHVWTKSKFL-GLSIGVH 580
            ::.:....|        :...|:||||||||::||...:....::...:...|:.|. .|::.|.
Yeast   124 KNDEHPEFG--------ETVLLSEQVSHHPPMTAFSIFNEKNDVSVQGYNQIKTGFTKTLTLTVK 180

  Fly   581 NIGEGVVTLVDRSEEYIVTFPNGYGRSILTV-PWIELGGSVEIKCPQSGYYANVEFLTKPFYGGK 644
            ..|..::.:.|  |.|::|.|..:...||.. |::||||...|: ..:|....:||..:.::.||
Yeast   181 PYGHVILKIKD--ETYLITTPPLHIEGILVASPFVELGGRSFIQ-SSNGMLCVIEFSGRGYFTGK 242

  Fly   645 RNRVSAEVY-APSE----KKPFVSITGEWSGLMEAKWHDKNKTEVFVDVNRIPIFKKQVRPIVEQ 704
            :|...|.:| :|.|    :.....|:|:|||:......|...:..|.|.:..|.....|:||.||
Yeast   243 KNSFKARIYRSPQEHSHKENALYLISGQWSGVSTIIKKDSQVSHQFYDSSETPTEHLLVKPIEEQ 307

  Fly   705 DEYESRRVWKEVTAGLKFNDIERATTAKFVVEQQQRDQAKVRKEYDLAWEHKHFKPV 761
            ...||||.||:|...::..:|......|..:|.:||...:..:...:.|:.:.||.|
Yeast   308 HPLESRRAWKDVAEAIRQGNISMIKKTKEELENKQRALREQERVKGVEWQRRWFKQV 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1513NP_610534.3 PH_ORP9 24..125 CDD:241444
PH 25..118 CDD:278594
Oxysterol_BP 421..767 CDD:279564 106/371 (29%)
HES1NP_014880.3 Oxysterol_BP 12..365 CDD:395990 106/371 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10972
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.