DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1513 and ORP4A

DIOPT Version :9

Sequence 1:NP_610534.3 Gene:CG1513 / 36028 FlyBaseID:FBgn0033463 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_194316.2 Gene:ORP4A / 828692 AraportID:AT4G25860 Length:386 Species:Arabidopsis thaliana


Alignment Length:383 Identity:114/383 - (29%)
Similarity:171/383 - (44%) Gaps:44/383 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 EEEEETDLSMEAHGSMITHLLSQVKIGMDLTKVVLPTFILERRSLLEMYADY---FAHPDLFIKI 464
            |:|::::|:..:....|..|:..|:.|.|||...||..::..||.|:.|.:.   |...||..:.
plant    20 EDEKDSELTASSVIRKILSLIKTVRPGSDLTNFQLPPQLILPRSRLQCYGEMIYSFGGQDLLGEC 84

  Fly   465 SDLDDPRDRIVQVCRWYMSAYHAGRKSAVAKKPYNPILGEVFQCHWDIPGISQDAQEVRDGPVPW 529
            |..:.|.:|:..|..|.:|..   |...|...||||||||              ...|.:|    
plant    85 SRRNIPIERLKSVVTWNISTL---RPVVVGMSPYNPILGE--------------THHVSNG---- 128

  Fly   530 CRRDQLTFLAEQVSHHPPISAFYAEHYNKKITFAAHVWTKSKFLGLSIGVHNIGEGVVTLVDRSE 594
                .:..|.|||.||||:||.:|.|..:.|......:...||.|..:.|...|:.::.|:...|
plant   129 ----YINVLTEQVMHHPPVSALHATHEQENIDVTWCQYFTPKFRGAYVDVEVNGKRIMKLLHHKE 189

  Fly   595 EYIVTFPNGYGRSI---LTVPWIELGGSVEIKCPQSGYYANVEFLTKPF---YGGKRNR-VSAEV 652
            .|.:..|    |.|   |..|.....|.|:||||::...|.:..::..|   :.|..|| :..::
plant   190 TYEMDQP----RLIMKFLPAPGAHWAGKVKIKCPETDLEAELHLISDSFIERFRGNNNRSIKGKI 250

  Fly   653 YAPSEKKPFVSITGEWSGLMEAKWHDKNKTEVFVDVNR--IPIFKKQVRPIVEQDEYESRRVWKE 715
            :..|......:|.|.|...:.||.......||..:.|.  ..:....|:.:.|..|.||..||.|
plant   251 FESSSGNQLYNIFGHWDRTVMAKNLKTGGLEVIYNANENITGLKPPTVKNLQEVMESESTIVWSE 315

  Fly   716 VTAGLKFNDIERATTAKFVVEQQQRDQAKVRKEYDLAWEHKHFKPV--GDNWIYAKPL 771
            |:.|:...|.|||..||.:||::||:..|.|:....:|..|||..|  |.:| :..||
plant   316 VSEGILKKDWERAREAKILVEEKQREALKQREASGESWVPKHFSVVKDGKDW-HCSPL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1513NP_610534.3 PH_ORP9 24..125 CDD:241444
PH 25..118 CDD:278594
Oxysterol_BP 421..767 CDD:279564 108/359 (30%)
ORP4ANP_194316.2 Oxysterol_BP 38..363 CDD:279564 106/353 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 145 1.000 Domainoid score I1472
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D949920at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1082
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10972
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.