DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1513 and Osbpl5

DIOPT Version :9

Sequence 1:NP_610534.3 Gene:CG1513 / 36028 FlyBaseID:FBgn0033463 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001015024.2 Gene:Osbpl5 / 361686 RGDID:1308402 Length:898 Species:Rattus norvegicus


Alignment Length:497 Identity:154/497 - (30%)
Similarity:239/497 - (48%) Gaps:67/497 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 ATSYSSSEGEEDFYDAYDDPFTSIGSSPIGCATRGFAETTS---PTHEKAPDGFANAEPVAVGDS 358
            :|.....:||:             ||||....:..:...||   |..:..|...:..|..|..|.
  Rat   275 STCKQGRDGEQ-------------GSSPDASPSSLYGLPTSATIPDQDLFPLNGSALENDAFSDK 326

  Fly   359 VAPQTLPEIDESVADADTSIKTARTAVSS-----------RSASYDNGIDYD-ALYEEEEETDLS 411
            ...:   ..|:|  ||:|...:.:|..|.           |..:|...:..: ...:|..:.:..
  Rat   327 SERE---NADDS--DAETQDHSRKTNESGSDLLDSPGGPRRGTTYVEQVQEELGELDETSQVETV 386

  Fly   412 MEAHGSMITHLLSQVKIGMDLTKVVLPTFILERRSLLEMYADYFAHPDLFIKISDLDDPRDRIVQ 476
            .|.:.|::..||.|::.||||::||||||:||.||.|...:||:.|.||..:.:..|||..||..
  Rat   387 SEENKSLMWVLLRQLRPGMDLSRVVLPTFVLEPRSFLSKLSDYYYHGDLLSRAAAEDDPYCRIKL 451

  Fly   477 VCRWYMSAYHAGRKSAVAKKPYNPILGEVFQCHWDIPGISQDAQEVRDGPVPWCRRDQLTF-LAE 540
            |.|||:|.::  :|....||||||||||.|:|.|..|                 :.:..|| :||
  Rat   452 VLRWYLSGFY--KKPKGIKKPYNPILGETFRCCWLHP-----------------QTNSHTFYIAE 497

  Fly   541 QVSHHPPISAFYAEHYNKKITFAAHVWTKSKFLGLSIGVHNIGEGVVTLVDRSEEYIVTFPNGYG 605
            |||||||:||||..:.......:..:..||||.|.|:.....|:..:|.::|.|||.:|.|..:.
  Rat   498 QVSHHPPVSAFYVSNRKDGFCMSGSITAKSKFYGNSLSALLDGKAKLTFLNRKEEYTLTMPYAHC 562

  Fly   606 RSIL--TVPWIELGGSVEIKCPQSGYYANVEFLTKPFYGGKR--NRVSAEVYAPSEKKPFVSITG 666
            |.:|  |:. :||||.|.|:|.::...|.::|..|||:|...  |::|.::  .|.::....:||
  Rat   563 RGLLYGTMT-MELGGKVTIQCEKNNLQAELDFKLKPFFGSSTSINQISGKI--TSGEEVLARLTG 624

  Fly   667 EWSGLMEAKWHDKNKTEVF----VDVNRIPIFKKQVRPIVEQDEYESRRVWKEVTAGLKFNDIER 727
            .|...:..|......|::|    .:|.|..: |:....:.||.|.||.|:|:.||..:...|..:
  Rat   625 HWDRDVFIKEEASGGTKLFWTPSEEVRRQRL-KRHTVLLEEQSELESERLWQHVTRAIHEGDQHK 688

  Fly   728 ATTAKFVVEQQQRDQAKVRKEYDLAWEHKHF--KPVGDNWIY 767
            ||..|.|:|:.||.:|:..::....|:.:.|  .|:...|.|
  Rat   689 ATQEKSVLEEAQRQRAREHQQSLTPWKPQLFTLDPLTQEWRY 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1513NP_610534.3 PH_ORP9 24..125 CDD:241444
PH 25..118 CDD:278594
Oxysterol_BP 421..767 CDD:279564 127/356 (36%)
Osbpl5NP_001015024.2 PH_OPR5_ORP8 144..272 CDD:270103
PH 151..267 CDD:278594
Oxysterol_BP 397..732 CDD:279564 128/357 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D949920at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.