DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1513 and SPBC646.08c

DIOPT Version :9

Sequence 1:NP_610534.3 Gene:CG1513 / 36028 FlyBaseID:FBgn0033463 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_595366.1 Gene:SPBC646.08c / 2541093 PomBaseID:SPBC646.08c Length:516 Species:Schizosaccharomyces pombe


Alignment Length:468 Identity:108/468 - (23%)
Similarity:178/468 - (38%) Gaps:122/468 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 YEEEEETDLSMEAHGSMITHLLSQVKIGM-DLT--KVVLPTFILERRSLLEMYADYFAHPDLFIK 463
            |::|       |....::..:|.|. ||: |:.  :..||..:||....|| |.:|...||.|..
pombe    33 YQKE-------EGKFKLVLSILKQC-IGVKDIASLRFSLPAQLLEPVGNLE-YWNYVDRPDYFAV 88

  Fly   464 ISDLDDPRDRIVQVCRWYMS---AYHAGRKSAVAKKPYNPILGEVFQCHWDI--PGI-------- 515
            :.|.||..:|::.|.||:.:   .:..||    ..||||.:|||.|:|.|.:  |.:        
pombe    89 MGDSDDELERMLGVLRWWFTKDLRFVRGR----VVKPYNSVLGEFFRCKWVVTDPTVREDHTLDP 149

  Fly   516 --------------------------------------------------------------SQD 518
                                                                          :||
pombe   150 DSSQLPTYKTEYSETTKFPLGKSYRPKASRTTSSQSVASTMTKSSTKTSKKKSSKKNSKSESNQD 214

  Fly   519 AQEVRDGPVPWC-------------RRDQLTFLAEQVSHHPPISAFYAEHYNKKITFAAHVWTKS 570
            :...|....|..             .:..:.|:|||.||||.:||||....:|.|..........
pombe   215 SSNDRSSTAPSTAESNNEHLSSSQKSKHSIVFMAEQTSHHPAVSAFYVTCPSKGIEVYGQDQIAV 279

  Fly   571 KFLGLSIGV--HNIGEGVVTLVDR--SEEYIVTFPNGYGRSILTVP-WIELGGSVEIKCPQSGYY 630
            .|.|.|..|  .::.:||....::  :|||:.|.|:.....||... .|.|..|..|.||::...
pombe   280 GFTGTSFKVCAGDLNKGVYVRFNKRDNEEYLCTHPSASVGGILRGNLHINLLDSTVILCPKTRIK 344

  Fly   631 ANVEFLTKPFYGGKRNRVSAEVY-------------APSEKKPFVSITGEWSGLMEAKWHDKNKT 682
            ..:.::.:.:.|..|:.|....|             |..::....:..|.|...:...:..::::
pombe   345 TIITYIEERWLGKPRSLVEGVCYRYDPSNDTIDSIKAVPKENILATFKGNWRNCIFYSYAGESES 409

  Fly   683 EVFVDVNRIPIFKKQVRPIVEQDEYESRRVWKEVTAGLKFNDIERATTAKFVVEQQQRDQAKVRK 747
            .:.||:|.:.:..|:..|:.:|..:|||::|..||..:......:||.||..:|.|||..:..|:
pombe   410 RMLVDLNELDLVHKRCPPLDKQFPFESRKIWFPVTHNILAKHYTQATKAKQEIEDQQRQASAARE 474

  Fly   748 EYDLAWEHKHFKP 760
            |....|:.:.|.|
pombe   475 ESHTEWKPRFFVP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1513NP_610534.3 PH_ORP9 24..125 CDD:241444
PH 25..118 CDD:278594
Oxysterol_BP 421..767 CDD:279564 105/449 (23%)
SPBC646.08cNP_595366.1 Oxysterol_BP 43..499 CDD:279564 105/451 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.