DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1513 and SPBC354.07c

DIOPT Version :9

Sequence 1:NP_610534.3 Gene:CG1513 / 36028 FlyBaseID:FBgn0033463 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_595231.3 Gene:SPBC354.07c / 2540947 PomBaseID:SPBC354.07c Length:397 Species:Schizosaccharomyces pombe


Alignment Length:335 Identity:101/335 - (30%)
Similarity:161/335 - (48%) Gaps:26/335 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 DLTKVVLPTFILERRSLLEMYADYFAHPDLFIKISDLDDPRDRIVQVCRWY---MSAYHAGRKS- 491
            ||:.:..|:|||...||||..:.:|..|:||:.|.|...|::|::.|.:||   :|..:|.|.. 
pombe    37 DLSTLSAPSFILSGTSLLEYMSYWFEFPELFVTIVDFPTPKERMLAVLKWYITGLSREYASRNKN 101

  Fly   492 -AVAKKPYNPILGEVFQCHWDIPGISQDAQEVRDGPVPWCRRDQLTFLAEQVSHHPPISAFYAEH 555
             ...|||.||||||:|...||                  ..:.::...|||||||.|.||.:...
pombe   102 YGTEKKPLNPILGELFYGSWD------------------SSKGKVELTAEQVSHHGPESAAHVVC 148

  Fly   556 YNKKITFAAHVWTKSKFLGLSIGVHNIGEGVVTLVDRSEEYIVTFPNGYGRSI-LTVPWIELGGS 619
            ....||...|...:|.|.|.::.|:.:|:..|.|...:|.|.:|.||.....: ...|:|||.||
pombe   149 KEAGITVDTHNKYRSGFSGRTVYVNQLGQLRVHLEKYNETYYITLPNISLEGLWFMAPYIELYGS 213

  Fly   620 VEIKCPQSGYYANVEFLTKPFYGGKRNRVSAEVYAPSEKKPFVSITGEWSGLMEAKWHDKNKTEV 684
            ..| ...:.|...:::..:.::.|.:|...|.::..:|...:: :.|.|:|..:........|..
pombe   214 TYI-VSNTNYITKIDYSGRGYFRGTKNSFKATIFEKNEDPDYI-VEGVWTGESKLTIPSLKSTIF 276

  Fly   685 FVDVNRIPIFKKQVRPIVEQDEYESRRVWKEVTAGLKFNDIERATTAKFVVEQQQRDQAKVRKEY 749
            |:.:..:......|:|..|..::|||.|||||:|.|...:.:..::.|..:||.|||..|..:..
pombe   277 FLSIPSLEATPITVKPESEMGDWESRNVWKEVSAALASGNYDIVSSKKSTIEQSQRDMRKKEEAE 341

  Fly   750 DLAWEHKHFK 759
            ...|..::||
pombe   342 GAVWARRYFK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1513NP_610534.3 PH_ORP9 24..125 CDD:241444
PH 25..118 CDD:278594
Oxysterol_BP 421..767 CDD:279564 101/335 (30%)
SPBC354.07cNP_595231.3 Oxysterol_BP 37..358 CDD:279564 101/335 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10972
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.