DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1513 and kes1

DIOPT Version :9

Sequence 1:NP_610534.3 Gene:CG1513 / 36028 FlyBaseID:FBgn0033463 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001342777.1 Gene:kes1 / 2540206 PomBaseID:SPBC1271.12 Length:388 Species:Schizosaccharomyces pombe


Alignment Length:419 Identity:133/419 - (31%)
Similarity:197/419 - (47%) Gaps:68/419 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 SRSASYDNGIDYDALYEEEEETDLSMEAHGSMITHLLSQVKIGMDLTKVVLPTFILERRSLLEMY 451
            |::.|.|:..|      .|.:..|......:.::.|.|......||:.:..|:|||...||:| |
pombe     2 SKTTSSDDSRD------GEGDKRLRSTTKSTWLSFLKSIATFSGDLSSLTAPSFILSSTSLIE-Y 59

  Fly   452 ADYFA-HPDLFIKISDLDDPRDRIVQVCRWYMSA---YHAGRKSAVA--KKPYNPILGEVFQCHW 510
            :.|:| ||:|||.:...:.|.:|.:.|.:|:.|.   .:|.|.....  |||.||||||:|...|
pombe    60 SAYWAEHPELFISLPRGETPLERQLLVTKWFASTLKNQYAARNERYGSEKKPLNPILGELFTGKW 124

  Fly   511 DIPGISQDAQEVRDGPVPWCRRDQLTFLAEQVSHHPPISAFYAEHYNKK--ITFAAHVWTKSKFL 573
            : ..|.:|.              :||  :|||||||||:|::.  ||||  :....:...||.|.
pombe   125 N-TDIGEDT--------------ELT--SEQVSHHPPITAYHI--YNKKAGVRLEGYNGHKSGFS 170

  Fly   574 GLSIGVHNIGEGVVTLVDRSEEYIVTFP----NG--YGRSILTVPWIELGGSVEIKCPQSGYYAN 632
            |..|.|..||...:.|...:|.|.:|||    .|  ||.     |:||||....| ...|||...
pombe   171 GPQIHVKQIGHARLILEPHNEVYYITFPLVTLEGLWYGS-----PYIELGKKSYI-ISTSGYLTT 229

  Fly   633 VEFLTKPFYGGKRNRVSAE-VYAPSEKKPFVSITGEWSGLME-AKWHDKNKT--EVFVDVNRIPI 693
            :|:..|.::.||:|...|. |.|.::.:|...|.|.|:|::: ..:.|:.::  |.|:|......
pombe   230 IEYSGKGYFTGKKNTFKATIVNAKTKSEPIYRIEGSWTGMLKYCTFEDQKRSAWEDFLDCGNYKP 294

  Fly   694 FKKQVRPIVEQDEYESRRVWKEVTAGLKFNDIERATTAKFVVEQQQRDQAKVRKEYDLAWEHKHF 758
            ....|.||.||.|||||||||.....|...|...|:..|..:|:.||:..:..:|::..|..|:|
pombe   295 VNISVAPIEEQGEYESRRVWKNFAVALDAGDYAAASQEKSKIEEGQRELRRQEEEHNEVWHRKYF 359

  Fly   759 -----------------KPVGDN-WIYAK 769
                             :||.:. |.|.:
pombe   360 EWKDKDEGFEEATKCLRQPVKEGFWYYLR 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1513NP_610534.3 PH_ORP9 24..125 CDD:241444
PH 25..118 CDD:278594
Oxysterol_BP 421..767 CDD:279564 126/381 (33%)
kes1NP_001342777.1 Oxysterol_BP 28..370 CDD:307410 123/367 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10972
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R635
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.