DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1513 and SPCC23B6.01c

DIOPT Version :9

Sequence 1:NP_610534.3 Gene:CG1513 / 36028 FlyBaseID:FBgn0033463 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_588124.2 Gene:SPCC23B6.01c / 2539266 PomBaseID:SPCC23B6.01c Length:479 Species:Schizosaccharomyces pombe


Alignment Length:367 Identity:126/367 - (34%)
Similarity:199/367 - (54%) Gaps:20/367 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 YEEEEETDLSMEAHG-SMITHLLSQVKIGMDLTKVVLPTFILERRSLLEMYADYFAHPDLFIKIS 465
            :|:::.....:|..| ::|..::||::..|||:||..|||:||.:|:||...::.:||||.:.:.
pombe     3 HEKQDRDAEEIEDEGKNIILGIVSQLRPNMDLSKVTFPTFVLEPKSMLERITNFMSHPDLLLNVQ 67

  Fly   466 DLDDPRDRIVQVCRWYMSAYHAGRKSAVAKKPYNPILGEVFQCHWDI-PGISQD--AQEVRDGPV 527
            ...||..|.:.|.|:|||.:|...:.  .|||.||||||.|...|.. |..|:|  .|::....|
pombe    68 KTADPEMRFLDVVRFYMSGWHIRPRG--VKKPLNPILGETFTGFWKFPPSNSKDPNLQKLHGIAV 130

  Fly   528 PWCRRDQLTFLAEQVSHHPPISAFYAEHYNKKITFAAHVWTKSKFLGLSIGVHNIGEGV--VTLV 590
                     :.||||.|||||||::......|:.....|..:|:|||.|..  :|.||:  :.|.
pombe   131 ---------YAAEQVCHHPPISAYFYLCPEYKVRIDGVVKPRSRFLGNSAA--SIMEGIASIKLQ 184

  Fly   591 DRSEEYIVTFPNGYGRSILTVPW-IELGGSVEIKCPQSGYYANVEFLTKPFYGGKRNRVSAEVYA 654
            |..|||::|.||.|.|.||.... :|||..|.::||::...|::||..|.|..|..|.::.:|..
pombe   185 DLDEEYLITQPNVYARGILFGKMRLELGDHVTVRCPKTDLQADIEFKVKGFISGTYNSIAGKVKR 249

  Fly   655 PSEKKPFVSITGEWSGLMEAKWHDKNKTEVFVDVNRIPIFKKQVRPIVEQDEYESRRVWKEVTAG 719
            .|..:....|:|:|...|..:.....:|...:||::..::....||:.||.|.||:|:|.:....
pombe   250 VSTGEVLYKISGKWDSEMSVESVKTGETRPLLDVSKHDVYLVSARPLEEQGERESQRLWYKTCQA 314

  Fly   720 LKFNDIERATTAKFVVEQQQRDQAKVRKEYDLAWEHKHFKPV 761
            :...|...||..|..:|.:||::||.|:..::.|:.|:||.:
pombe   315 VIARDQTTATETKSAIEDRQREEAKQREIENVQWKPKYFKMI 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1513NP_610534.3 PH_ORP9 24..125 CDD:241444
PH 25..118 CDD:278594
Oxysterol_BP 421..767 CDD:279564 122/347 (35%)
SPCC23B6.01cNP_588124.2 Oxysterol_BP 26..354 CDD:279564 120/340 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R635
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.