DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and ELO3

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_013476.3 Gene:ELO3 / 851087 SGDID:S000004364 Length:345 Species:Saccharomyces cerevisiae


Alignment Length:201 Identity:41/201 - (20%)
Similarity:71/201 - (35%) Gaps:55/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1162 ARVTTEGNSENENSS------VEKKENQFLLE------RAKEIFFAEGSKD----HNLKYLICTS 1210
            |.|..:..|.|.:||      |...||.|.:|      :..|.|....::.    ||..:|   :
Yeast    10 AAVADQFQSLNSSSSCFLKVHVPSIENPFGIELWPIFSKVFEYFSGYPAEQFEFIHNKTFL---A 71

  Fly  1211 EGLMRTIWRILYQLDLQEFSYYTSIHDGEDLYKSEDNLHLCFRHVVDHGN----------WPVNL 1265
            .|         |........||..|..|:.:.::.:...|.|:.:.:..|          |.:.|
Yeast    72 NG---------YHAVSIIIVYYIIIFGGQAILRALNASPLKFKLLFEIHNLFLTSISLVLWLLML 127

  Fly  1266 CVLLPRLKHLLHSKGVQLDRLNLSKISPKIFSPWELGTYSDFDQIVAQEYIHRTGEEIEDVVKLC 1330
            ..|:|.:.|    .|:.....:....:||:.:.:.|...:.|.:::             |.|.|.
Yeast   128 EQLVPMVYH----NGLFWSICSKEAFAPKLVTLYYLNYLTKFVELI-------------DTVFLV 175

  Fly  1331 QEREKL 1336
            ..|:||
Yeast   176 LRRKKL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
ELO3NP_013476.3 ELO 88..307 CDD:395916 20/111 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.