DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and Elovl4

DIOPT Version :10

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:39 Identity:14/39 - (35%)
Similarity:21/39 - (53%) Gaps:4/39 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FYNRFYMYPEK----RSPTNIFNATTEIPLEKLLESGKP 226
            ||.|.|..|::    ::.||..::......||.||:|||
Mouse   265 FYTRTYNEPKQSKTGKTATNGISSNGVNKSEKALENGKP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
Elovl4NP_683743.2 ELO 41..278 CDD:460083 5/12 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312 10/31 (32%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.