DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and Elovl4

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:39 Identity:14/39 - (35%)
Similarity:21/39 - (53%) Gaps:4/39 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FYNRFYMYPEK----RSPTNIFNATTEIPLEKLLESGKP 226
            ||.|.|..|::    ::.||..::......||.||:|||
Mouse   265 FYTRTYNEPKQSKTGKTATNGISSNGVNKSEKALENGKP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
Elovl4NP_683743.2 ELO 41..277 CDD:279492 5/11 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312 10/31 (32%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.