DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and HOS3-1

DIOPT Version :10

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:110 Identity:23/110 - (20%)
Similarity:33/110 - (30%) Gaps:51/110 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   808 PGEECPPYPVSLEL------FKSHV---------------------SNLDDIANNMQKCVEYRGK 845
            ||...|.:.|:.:|      ..||.                     |.|:||.....||.: ||.
plant   209 PGSAFPSFVVNCQLVLVGCNLVSHAGVLTMHLFKGGCNGIGAWGLNSVLNDIPQYPPKCGD-RGN 272

  Fly   846 SKDEVIRDYYKGFYSGPEMREKFACRFKPCTGHILQQLLSYPGKN 890
                      ||.:.|...|             :::.|.|.|.:|
plant   273 ----------KGLHGGSWTR-------------MIKSLYSLPSEN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
HOS3-1NP_001329164.1 ELO 30..258 CDD:470741 8/48 (17%)

Return to query results.
Submit another query.