DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and ELOVL6

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_001124193.1 Gene:ELOVL6 / 79071 HGNCID:15829 Length:265 Species:Homo sapiens


Alignment Length:153 Identity:27/153 - (17%)
Similarity:57/153 - (37%) Gaps:45/153 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1224 LDLQEFSYYTSIHDGEDLYKSEDN---------LHLCF----RHVVDHGN----------WPVNL 1265
            |.|||:.:....::.|.:...::|         |:..|    ||:::...          |.:.|
Human     6 LTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTL 70

  Fly  1266 CV--LLPRLK------HLLHSKGVQLDRLNLSKISPKIFSPWELGTYS-DFDQIVAQEYIHRTGE 1321
            .|  :...|:      ::|.:||::.             |..:.|.|: ...:..|..::.....
Human    71 AVFSIFGALRTGAYMVYILMTKGLKQ-------------SVCDQGFYNGPVSKFWAYAFVLSKAP 122

  Fly  1322 EIEDVVKLCQEREKLYACCWAHN 1344
            |:.|.:.:...::||....|.|:
Human   123 ELGDTIFIILRKQKLIFLHWYHH 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
ELOVL6NP_001124193.1 ELO 25..260 CDD:395916 22/134 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.