DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and elovl2

DIOPT Version :10

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:XP_073796653.1 Gene:elovl2 / 678614 ZFINID:ZDB-GENE-060421-5612 Length:295 Species:Danio rerio


Alignment Length:95 Identity:18/95 - (18%)
Similarity:29/95 - (30%) Gaps:30/95 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1213 LMRTIWRILYQLDLQEFS----------------YYTSIHDGED---LYKSEDNLHLCFRHVVDH 1258
            |:..:|...|:|..|...                |::.:.:..|   :...:.|..:.|.||..|
Zfish    86 LISAVWSAGYRLQCQALDEVGEADIRVAKVLWWYYFSKLIEFLDTIFIVLRKKNSQISFLHVYHH 150

  Fly  1259 G----------NW-PVNLCVLLPRLKHLLH 1277
            .          || |.......|.|...:|
Zfish   151 ASMFNIWWCVLNWIPCGQSFFGPTLNSFIH 180

Return to query results.
Submit another query.