powered by:
Protein Alignment tea and ELOVL5
DIOPT Version :9
Sequence 1: | NP_724855.2 |
Gene: | tea / 36027 |
FlyBaseID: | FBgn0285892 |
Length: | 1878 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001229757.1 |
Gene: | ELOVL5 / 60481 |
HGNCID: | 21308 |
Length: | 326 |
Species: | Homo sapiens |
Alignment Length: | 74 |
Identity: | 20/74 - (27%) |
Similarity: | 33/74 - (44%) |
Gaps: | 12/74 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 1744 ATYQKALVKINDKLCNVRGPLISSLFPYLSSTLRSDLELVLHDLGEFFYKRSWPAHTDATVDFRK 1808
:||.|||:...| ..|:|..: |..|:.:.:.|.:.|::..||..:.:...| |..
Human 9 STYFKALLGPRD--TRVKGWFL--LDNYIPTFICSVIYLLIVWLGPKYMRNKQP--------FSC 61
Fly 1809 RVLFVFMNL 1817
|.:.|..||
Human 62 RGILVVYNL 70
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tea | NP_724855.2 |
None |
ELOVL5 | NP_001229757.1 |
ELO |
27..288 |
CDD:366492 |
12/54 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3071 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.