DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and ELOVL5

DIOPT Version :10

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:74 Identity:20/74 - (27%)
Similarity:33/74 - (44%) Gaps:12/74 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1744 ATYQKALVKINDKLCNVRGPLISSLFPYLSSTLRSDLELVLHDLGEFFYKRSWPAHTDATVDFRK 1808
            :||.|||:...|  ..|:|..:  |..|:.:.:.|.:.|::..||..:.:...|        |..
Human     9 STYFKALLGPRD--TRVKGWFL--LDNYIPTFICSVIYLLIVWLGPKYMRNKQP--------FSC 61

  Fly  1809 RVLFVFMNL 1817
            |.:.|..||
Human    62 RGILVVYNL 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
ELOVL5NP_001229757.1 ELO 27..287 CDD:460083 12/54 (22%)

Return to query results.
Submit another query.