DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and ELOVL5

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:74 Identity:20/74 - (27%)
Similarity:33/74 - (44%) Gaps:12/74 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1744 ATYQKALVKINDKLCNVRGPLISSLFPYLSSTLRSDLELVLHDLGEFFYKRSWPAHTDATVDFRK 1808
            :||.|||:...|  ..|:|..:  |..|:.:.:.|.:.|::..||..:.:...|        |..
Human     9 STYFKALLGPRD--TRVKGWFL--LDNYIPTFICSVIYLLIVWLGPKYMRNKQP--------FSC 61

  Fly  1809 RVLFVFMNL 1817
            |.:.|..||
Human    62 RGILVVYNL 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.