DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and Elovl2

DIOPT Version :10

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_062296.1 Gene:Elovl2 / 54326 MGIID:1858960 Length:292 Species:Mus musculus


Alignment Length:135 Identity:27/135 - (20%)
Similarity:46/135 - (34%) Gaps:43/135 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IVNVERCGAFIFPVSFDVFLQCI-------------NKMLLFKK---------IVRSIEH----- 174
            ::|...||...|..:.:.|:..:             :|.|.:||         .|.:|.|     
Mouse   160 VLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTLSAV 224

  Fly   175 ---------CLVLLSDDERRLLTLQRFYNRFYMYPEKRSPTNIFNATTEI----PLEKLLESGKP 226
                     ||:..|.   .::||...:..||:...::.|........|:    |...|:.:...
Mouse   225 VKPCGFPFGCLIFQSS---YMMTLVILFLNFYIQTYRKKPVKKELQEKEVKNGFPKAHLIVANGM 286

  Fly   227 LDKKA 231
            .||||
Mouse   287 TDKKA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
Elovl2NP_062296.1 ELO 30..264 CDD:460083 20/106 (19%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03202 289..292 3/3 (100%)

Return to query results.
Submit another query.