DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and Elovl2

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:XP_038951934.1 Gene:Elovl2 / 498728 RGDID:1308605 Length:296 Species:Rattus norvegicus


Alignment Length:143 Identity:27/143 - (18%)
Similarity:48/143 - (33%) Gaps:57/143 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IVNVERCGAFIFPVSFDVFLQCI-------------NKMLLFKK---------IVRSIEH----- 174
            ::|...||...|..:.:.|:..:             ::.|.:||         .|.:|.|     
  Rat   160 VLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHRYLWWKKYLTQAQLVQFVLTITHTLSAV 224

  Fly   175 ---------CLVLLSDDERRLLTLQRFYNRFYMYPEKRSPTNIFNATTEIP---LEKLLESGKP- 226
                     ||:..|.   .::||...:..||:...::.|..     .|:|   ..|.:::|.| 
  Rat   225 VKPCGFPFGCLIFQSS---YMMTLVILFLNFYIQTYRKKPMK-----KEMPEGAAGKEVKNGFPK 281

  Fly   227 ---------LDKK 230
                     .|||
  Rat   282 AHSIAANGVTDKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
Elovl2XP_038951934.1 ELO 30..264 CDD:395916 19/111 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.