DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and CG5326

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster


Alignment Length:143 Identity:31/143 - (21%)
Similarity:50/143 - (34%) Gaps:38/143 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1181 ENQFLLERAKE-----IFFAEGSK-----DHNLKYLICTSEG------LMRTIWRILYQLDLQEF 1229
            :|..|:..|.:     :.|.||.|     .:|.|....|.|.      :.|.:|  ||.:     
  Fly    67 KNTLLVYNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVW--LYYI----- 124

  Fly  1230 SYYTSIHDGEDLYKSEDNLHLCFRHVVDHGNWPVNLCVLLPRLKHLLHSKGVQLDRLN------- 1287
            :..|.:.|.......:....:.|.|:..|...||  |..: .:|:.....|..|..:|       
  Fly   125 AKITELLDTVFFVLRKKQRQISFLHLYHHTLMPV--CAFI-GVKYFAGGHGTLLGFINSFIHIIM 186

  Fly  1288 -----LSKISPKI 1295
                 ||.:.||:
  Fly   187 YAYYLLSAMGPKV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
CG5326NP_651060.1 ELO 31..262 CDD:395916 31/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.