DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and CG9458

DIOPT Version :10

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster


Alignment Length:85 Identity:17/85 - (20%)
Similarity:32/85 - (37%) Gaps:24/85 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VIVNVERCGAFIFPVSF-----DVFLQCINKM----------------LLFKKIVRSIEHCLVLL 179
            ::.||..|   .|.|.|     |...:||..:                ..|.|::..:|....:|
  Fly    67 IVYNVIMC---FFAVHFMLGPGDYNFKCIKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVL 128

  Fly   180 SDDERRLLTLQRFYNRFYMY 199
            ...:|::..|..|::.:.:|
  Fly   129 RKKDRQISFLHVFHHMYMLY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
CG9458NP_731419.1 ELO 20..261 CDD:460083 17/85 (20%)

Return to query results.
Submit another query.