powered by:
Protein Alignment tea and CG8534
DIOPT Version :9
Sequence 1: | NP_724855.2 |
Gene: | tea / 36027 |
FlyBaseID: | FBgn0285892 |
Length: | 1878 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649955.1 |
Gene: | CG8534 / 41210 |
FlyBaseID: | FBgn0037761 |
Length: | 265 |
Species: | Drosophila melanogaster |
Alignment Length: | 52 |
Identity: | 15/52 - (28%) |
Similarity: | 25/52 - (48%) |
Gaps: | 15/52 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 146 FIFPV-SFDVFLQCINKMLLFKKIVRSIEHCLVLLSDDERRLLTLQRFYNRF 196
|:|.: ::| |:||.|: .::|.| ....|.||...|:|:|
Fly 79 FLFVLKAYD--LRCITKL--------PLDHEL----KSRERWLTYSYFFNKF 116
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tea | NP_724855.2 |
None |
CG8534 | NP_649955.1 |
ELO |
19..259 |
CDD:366492 |
15/52 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3071 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.