DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and CG8534

DIOPT Version :10

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster


Alignment Length:52 Identity:15/52 - (28%)
Similarity:25/52 - (48%) Gaps:15/52 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 FIFPV-SFDVFLQCINKMLLFKKIVRSIEHCLVLLSDDERRLLTLQRFYNRF 196
            |:|.: ::|  |:||.|:        .::|.|    ....|.||...|:|:|
  Fly    79 FLFVLKAYD--LRCITKL--------PLDHEL----KSRERWLTYSYFFNKF 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
CG8534NP_649955.1 ELO 19..259 CDD:460083 15/52 (29%)

Return to query results.
Submit another query.