DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and ELOVL

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster


Alignment Length:274 Identity:60/274 - (21%)
Similarity:93/274 - (33%) Gaps:70/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RTRD-NLLKVPEPG-GISQNDVANVAAAGPSQVE--QP----EVLVEGSQLTTLAETAKSHDA-- 118
            |||| .|:..|.|. .||......|...||..:|  :|    :||:..:....:......:::  
  Fly    22 RTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYESCI 86

  Fly   119 ---VEGVAVECKP-SGSESPDVIVNVERCGAFI---FPVSFDVFLQCINKMLLFKKIVRSIEHCL 176
               :.|..:.|:| :.|.||..|...|.|..:.   |...||.|...:.|.......:..|.|.:
  Fly    87 GGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVIHHGI 151

  Fly   177 VLLS------DDERRLLTLQRFYNRF---YMYPEKRSPTNIFNATTEIPLEKLLESGKPLDKKAV 232
            :.:|      .......|...|.|.|   :||                 ...:|.:..|..:|.:
  Fly   152 MPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMY-----------------AYYMLAAMGPKVQKYL 199

  Fly   233 KTVAELTAMKSLTKNSIV--SFEVFKKNMANLSDIVEQMRQLDANYASKDVQECALDYYLA---- 291
            .....||.|:.:....::  ||::|.||              |.||      .....|::.    
  Fly   200 WWKKYLTVMQMIQFVLVMVHSFQLFFKN--------------DCNY------PIGFAYFIGAHAV 244

  Fly   292 -FYITPRIRYKYAY 304
             ||......||.||
  Fly   245 MFYFLFSNFYKRAY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
ELOVLNP_649754.1 ELO 27..266 CDD:366492 56/269 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.