DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and CG31522

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster


Alignment Length:117 Identity:26/117 - (22%)
Similarity:49/117 - (41%) Gaps:26/117 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1048 KRYSVSTGHIVANTIAAEENEPQLSSNSVDIESVCTAQTTATDTQATEMHTIPKALDQSSEPTKE 1112
            |..:::.||...|......|...      |:....|.:.|||.|.|:      ||...|:.|:..
  Fly   292 KNGALANGHAKPNGYCKSINAHD------DLAMPQTTEATATATPAS------KANGSSTPPSNG 344

  Fly  1113 SSSVNLNNNLESPAKIKMIHAESSNNSRNSTNRPNTEIEAG-STKILEDGAR 1163
            .:     |.:|:      ::.:.:|.|.:..:  |..:..| :||:|:|.::
  Fly   345 HA-----NGVEN------VYKQVANGSAHKGS--NGGLSNGYATKLLDDASQ 383

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None