DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and elovl4a

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_957090.1 Gene:elovl4a / 393769 ZFINID:ZDB-GENE-040426-1767 Length:309 Species:Danio rerio


Alignment Length:121 Identity:26/121 - (21%)
Similarity:42/121 - (34%) Gaps:14/121 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 HGRFIFPVSLETFRQYINYDEIIRAILVNNHIKDEHQLSKLISDPSHPQCKKF------------ 591
            :|...|...::.|..:..|..||:  :|..|:...|....|.||...|:...:            
Zfish   188 YGLAAFGPKIQKFLWWKKYLTIIQ--MVQFHVTIGHTALSLYSDCPFPKWMHWCLIGYALTFIIL 250

  Fly   592 FRQFYNKFYARNDVRQRFKYKFNCPNPKMLAKLKQKAKPLDEKALFTMNRTDNAKA 647
            |..||.:.|.|...|.:.:...|..:...|.........|:||...:..|....:|
Zfish   251 FGNFYYQTYRRQPRRDKPRALHNGASNGALTSSNGNTAKLEEKPAESGRRRRKGRA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
elovl4aNP_957090.1 ELO 30..267 CDD:279492 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.