DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and CG32071

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_729667.1 Gene:CG32071 / 39246 FlyBaseID:FBgn0052071 Length:150 Species:Drosophila melanogaster


Alignment Length:108 Identity:24/108 - (22%)
Similarity:41/108 - (37%) Gaps:25/108 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1081 VCTAQTTATDTQATEMHTIPKALDQSSEPTKESSSVNLNNNLESPAKIKMIHAESSNNSRNSTNR 1145
            |..|......:|||           |:.||..||:...:::..||..     :.||.:|..:|..
  Fly    20 VILATLVVLSSQAT-----------STSPTSSSSTSPTSSSSTSPTS-----SSSSTSSATTTTT 68

  Fly  1146 PNTEIEAGSTKILEDGARVTTEGNSENENSSVEKKENQFLLER 1188
            ..|...|.:|      ...|||.:.:..|   .::..:.::.|
  Fly    69 TTTTTTAATT------TSTTTEKSKKKRN---RRRRRRIIIRR 102



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.